PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G129100.1.p
Common NameSb03g010980, SORBIDRAFT_03g010980
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 268aa    MW: 29918.3 Da    PI: 7.5254
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G129100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-1657102147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           rg W + Ed++l+d+v+++G+++W++Ia+++  gR++k+c++rw + 
  Sobic.003G129100.1.p  57 RGHWCPSEDDKLKDLVARYGPKNWRRIAEKLE-GRSGKSCRLRWINQ 102
                           899*****************************.***********985 PP

2Myb_DNA-binding52.11.5e-16109153147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           r+++++eE+e+l+ a + +G++ W++Iar ++ gRt++ +k++w+  
  Sobic.003G129100.1.p 109 RDAFSKEEEEQLLAARHAYGTK-WSLIARLFP-GRTDNAIKNHWHVM 153
                           789*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.5952107IPR017930Myb domain
SMARTSM007173.9E-1456105IPR001005SANT/Myb domain
SuperFamilySSF466891.39E-2756150IPR009057Homeodomain-like
PfamPF002499.3E-1657102IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-2558110IPR009057Homeodomain-like
CDDcd001674.44E-1460101No hitNo description
SMARTSM007171.4E-14108156IPR001005SANT/Myb domain
PROSITE profilePS5129419.348108158IPR017930Myb domain
PfamPF002496.9E-14109152IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-19111157IPR009057Homeodomain-like
CDDcd001673.76E-12111154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MDHLNPALPP TRALVPFQEG NKHVFIVEEA YDEHVEDHGT SNGHDGSSNQ GNRIMRRGHW  60
CPSEDDKLKD LVARYGPKNW RRIAEKLEGR SGKSCRLRWI NQLDPQLNRD AFSKEEEEQL  120
LAARHAYGTK WSLIARLFPG RTDNAIKNHW HVMMARKSRA IQDIKISSSS CPSSSTQGSP  180
HFMPIINIYH NYDNNMHPEL NVPVEAAASH IYHANEFNNS SSTNTTHLSI GGGSDMAPHG  240
RTPTATTDKG ADKFSPPFFD FLGVGNA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-28541571104C-Myb DNA-Binding Domain
1mse_C3e-28541571104C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002457640.10.0hypothetical protein SORBIDRAFT_03g010980
TrEMBLC5XH790.0C5XH79_SORBI; Putative uncharacterized protein Sb03g010980
STRINGSb03g010980.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-56myb domain protein 105